Protein Info for SMa1367 in Sinorhizobium meliloti 1021

Annotation: short chain alcohol dehydrogenase-related dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00106: adh_short" amino acids 7 to 193 (187 residues), 130.7 bits, see alignment E=7.2e-42 PF08659: KR" amino acids 7 to 177 (171 residues), 39.6 bits, see alignment E=8.1e-14 PF13561: adh_short_C2" amino acids 11 to 249 (239 residues), 164.7 bits, see alignment E=4.1e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1367)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YW4 at UniProt or InterPro

Protein Sequence (252 amino acids)

>SMa1367 short chain alcohol dehydrogenase-related dehydrogenase (Sinorhizobium meliloti 1021)
MTDAPRILITGAGSGIGAAIARRIATPGMRLFLHTGTNAEGLRTVAKEVSARGAEVATEL
GDLSDPTVPGHLVQAARAAFGGLDQIVSNAGRAQRSSFGQLTDADLQTAFDMMPMAFFRL
VDAALPDLRTSMQGRVVAVSSFVAHGFGTNGMHFPASGAAKAALEALAKSLAAQLAPVGV
TVNCVAPGFTRKDTGGHAATSSAAMESARAVTPNGRLGEPIDVAELVAFLLSPGARHITG
QVMHVDGGLLLA