Protein Info for SMa1339 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 81 to 109 (29 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 294 (195 residues), 58.6 bits, see alignment E=3.6e-20

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to sme:SMa1339)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YY0 at UniProt or InterPro

Protein Sequence (301 amino acids)

>SMa1339 ABC transporter permease (Sinorhizobium meliloti 1021)
MATVVMTSLDSKSRAASRGLSDIKIRNLFIIPTILFLIVFNIFPLIYSLGYSFTDFRAST
NAPATFVGLQNYRELLNDPFIWANFAITAKYVIVSVTGQVVVGFGTAMLLNREIPFKGLI
TTLLLLPMMLSMAVVGLFWKLLYDPSFGIINYALGLGSFEWLANPEMALYAVAITDIWMW
SPFVMLLSLAGLSAVPRHLYEAAAIDRAGPFYTFFRITLPLVAPILMIAIIFRTMEAFKT
FDLAYILTSQPTTEVISIRLYKMAFQEWQTGRSCALAYIVLIMVLAITNIYVKYLNRVKE
R