Protein Info for SMa1318 in Sinorhizobium meliloti 1021

Annotation: VirB3 type IV secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 transmembrane" amino acids 39 to 64 (26 residues), see Phobius details PF05101: VirB3" amino acids 9 to 92 (84 residues), 104.7 bits, see alignment E=1.2e-34

Best Hits

Swiss-Prot: 52% identical to VIRB3_BARHE: Type IV secretion system protein virB3 (virB3) from Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1)

KEGG orthology group: K03198, type IV secretion system protein VirB3 (inferred from 98% identity to smk:Sinme_5906)

Predicted SEED Role

"Inner membrane protein forms channel for type IV secretion of T-DNA complex (VirB3)" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YZ5 at UniProt or InterPro

Protein Sequence (113 amino acids)

>SMa1318 VirB3 type IV secretion protein (Sinorhizobium meliloti 1021)
MADSGPAFEEDTLFIACTRPAMIAGVTMEAMGMNIMLTTILYIVAGSVAYALVGVVFHLV
FRALVKHDHNMFRILLAWIETRGRSRNSAFWGGATLSPMKLARKYDERDLGFA