Protein Info for SMa1313 in Sinorhizobium meliloti 1021

Annotation: VirB5 type IV secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02791: P-type DNA transfer protein VirB5" amino acids 7 to 219 (213 residues), 245.5 bits, see alignment E=2.7e-77 PF07996: T4SS" amino acids 26 to 217 (192 residues), 193.3 bits, see alignment E=2.7e-61

Best Hits

KEGG orthology group: K03200, type IV secretion system protein VirB5 (inferred from 100% identity to sme:SMa1313)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YZ7 at UniProt or InterPro

Protein Sequence (233 amino acids)

>SMa1313 VirB5 type IV secretion protein (Sinorhizobium meliloti 1021)
MAFFRINCVVIASALILSATGAAGQGIPVIDQTAIAKQIESIAQLKAQLDALNQQIEQAQ
QLHGSLNKLTDMSDVASVLNDPAIRKALPADFSAIEGLFKGNGTGVFADSASKFLDGNTT
YQTNAADDFYAQELSRIQNKNAGQMSLGQQIYDAATKRIDGIDQLREKISTAGDAKDIAD
LQARLQAEQAFLQTDVLRMEGLRMVQQAQEQVDEQRKAEDWRQRMDAIKAALQ