Protein Info for SMa1308 in Sinorhizobium meliloti 1021

Annotation: VirB8 type IV secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 31 to 54 (24 residues), see Phobius details PF04335: VirB8" amino acids 13 to 220 (208 residues), 215.6 bits, see alignment E=3.7e-68

Best Hits

Swiss-Prot: 53% identical to VIRB8_BARQU: Type IV secretion system protein virB8 (virB8) from Bartonella quintana (strain Toulouse)

KEGG orthology group: K03203, type IV secretion system protein VirB8 (inferred from 100% identity to smk:Sinme_5900)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Z00 at UniProt or InterPro

Protein Sequence (223 amino acids)

>SMa1308 VirB8 type IV secretion protein (Sinorhizobium meliloti 1021)
MVSADELKTYFEKARRFDQDRVIQVERSARIAWSVAIVAGILAGASIFAVAALTPLKTIE
PFVVRVDNSTGIVDVVSALTSTAGTYDEAVTKYFAAKYVRAREGYVWSEAEENFRTVALL
STQPEQARFSAIYRGSNPDSPQNTYGRSATARISIASISLINPNVVSVRYMRTITRGEEV
RPTHWVATLTFSYVNSPMSSTDRLVNPLGFAVSEYRADPEAIN