Protein Info for SMa1239 in Sinorhizobium meliloti 1021

Annotation: NapD component of periplasmic nitrate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 PF03927: NapD" amino acids 8 to 81 (74 residues), 83 bits, see alignment E=6.3e-28

Best Hits

KEGG orthology group: K02570, periplasmic nitrate reductase NapD (inferred from 100% identity to sme:SMa1239)

Predicted SEED Role

"periplasmic diheme c-type cytochrome, NapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Z35 at UniProt or InterPro

Protein Sequence (95 amino acids)

>SMa1239 NapD component of periplasmic nitrate reductase (Sinorhizobium meliloti 1021)
MSDRSAPYHISSAVIVTMPHMRERVVGSLLEMPNVEVYAHEAGKIVVVIEGTSTGMLGES
LSRISTLEGVVAANMVFEHVETQGEVGHDRRTDAA