Protein Info for SMa1216 in Sinorhizobium meliloti 1021

Annotation: cbb3-type cytochrome c oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details PF02433: FixO" amino acids 7 to 231 (225 residues), 330.9 bits, see alignment E=1.8e-103 TIGR00781: cytochrome c oxidase, cbb3-type, subunit II" amino acids 7 to 238 (232 residues), 401.5 bits, see alignment E=6e-125

Best Hits

KEGG orthology group: K00405, cb-type cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 100% identity to smk:Sinme_5881)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D4J8 at UniProt or InterPro

Protein Sequence (243 amino acids)

>SMa1216 cbb3-type cytochrome c oxidase subunit II (Sinorhizobium meliloti 1021)
MSILDKHAILERNATLLLIGSLLVVSIGGIVEIAPLFYLENTIEKVEGMRPYSPLELAGR
DIYIREGCYVCHSQMIRPFRDEVERYGHYSLAAESMYDHPFQWGSKRTGPDLARVGDRYS
NEWHVQHMIEPRSVVPESVMPSYAFLKETPLEVKNVAMSLEANRAVGVPYTDEMIGNAAA
DLKAQADPNADGSGVEARYPKAKLGDFDGDPQRLTEMDALVAYLQMLGTLVDFSTYDDAA
GYR