Protein Info for SMa1208 in Sinorhizobium meliloti 1021

Annotation: FixS1 nitrogen fixation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 55 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details TIGR00847: cytochrome oxidase maturation protein, cbb3-type" amino acids 1 to 52 (52 residues), 95 bits, see alignment E=7.7e-32 PF03597: FixS" amino acids 2 to 44 (43 residues), 75.3 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 100% identical to FIXS_RHIME: Nitrogen fixation protein FixS (fixS) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SMa1208)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoS, involved in heme b insertion" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P18399 at UniProt or InterPro

Protein Sequence (55 amino acids)

>SMa1208 FixS1 nitrogen fixation protein (Sinorhizobium meliloti 1021)
MNTLIYLIPVALSLGGLGLVAFLWALKSGQYEDLDGASWRILDDGDGEGESSQTL