Protein Info for SMa1183 in Sinorhizobium meliloti 1021

Annotation: NosD nitrous oxidase accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR04247: nitrous oxide reductase family maturation protein NosD" amino acids 37 to 444 (408 residues), 465.2 bits, see alignment E=1.1e-143 PF05048: NosD" amino acids 159 to 378 (220 residues), 161.6 bits, see alignment E=1.8e-51 PF13229: Beta_helix" amino acids 165 to 270 (106 residues), 47.7 bits, see alignment E=1.4e-16 TIGR03804: parallel beta-helix repeat" amino acids 165 to 203 (39 residues), 22 bits, see alignment 1e-08

Best Hits

KEGG orthology group: K07218, nitrous oxidase accessory protein (inferred from 100% identity to sme:SMa1183)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosD" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D4K4 at UniProt or InterPro

Protein Sequence (453 amino acids)

>SMa1183 NosD nitrous oxidase accessory protein (Sinorhizobium meliloti 1021)
MSRPNISAFGMAALAAVILACPVSAATIRKSADGLPLQPVLDRASPGDVIVLQGEHQGPV
TIDKTLTLEGEPGALVMGNGKGSVITVKAPQSIVRGLEVRGSGKDLYGMDSGIFVAQTAS
GARVEKNTIIGNLVGIYLHGARDSWALGNRIIGLREGRISEAGDGISVWNAPGARVVDND
VSYGRDGIFSKTSKRNVFRGNRFRELRFAVHYMYTNDSEISDNVSTGNAVGYAIMYSDRL
KIKGNRSDGDRDHGLLLNYANNSRITGNIVVGRLQPADRWLKARSSGHGVPKTDEENQTA
GADRRLGPEKCVFIYNANKNRFRDNVFEGCAIGIHFTAGSEGNLISSNSFINNRNQVKYV
GTRHLDWSSEGQGNYWSDNPAFDLDGDGIGDNPYRPNDLIDKVLWTSPQAKLLTTSPAVQ
VIRWAQAQFPAILPGGVVDSRPLMVPAGRVAVQ