Protein Info for SMa1179 in Sinorhizobium meliloti 1021

Annotation: NosR regulatory protein for N2O reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 755 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 438 to 460 (23 residues), see Phobius details amino acids 472 to 497 (26 residues), see Phobius details amino acids 509 to 530 (22 residues), see Phobius details amino acids 574 to 596 (23 residues), see Phobius details amino acids 614 to 634 (21 residues), see Phobius details PF04205: FMN_bind" amino acids 89 to 164 (76 residues), 26 bits, see alignment E=1.2e-09 PF12801: Fer4_5" amino acids 513 to 558 (46 residues), 44.6 bits, see alignment 1.1e-15 amino acids 615 to 650 (36 residues), 26.3 bits, see alignment (E = 5.8e-10)

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1179)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosR" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Z50 at UniProt or InterPro

Protein Sequence (755 amino acids)

>SMa1179 NosR regulatory protein for N2O reductase (Sinorhizobium meliloti 1021)
MYQAAIHKNLFKRLLRGLVALCIAMLLAGPSMAAGQLSNYLQKVQPQQIFPGATRFGEVT
GDPPIAPVFRGESLLGYAYLNSDVTSSVGYSGKPIHIVVGIDPKGVVRGLKLVDHKEPIV
LIGIPEAKVVASVNALIGKDLGRVSAGVEGPPQVDIVSGATVTVLVMGDSIVRSALKLIR
GNRFGADAVAPEQSSEIRKVDLLRTGTSDWETLVGDGSVRSLRLTVGEVTEAFRQAGQPA
AADRPETHSPGDRFIDLYIAPVSVPVIGRSLLGDSRYEQMRAKLKPGEEAIVVAGDGAYS
FKGSGYVRGGIFDRIELIQDGQGLRFRDRYHTRLPTLAASGAPRLREIALFVVPADFGFD
IAAPWELQLLVQRSAVGRDKAVLPYNLSYVLPDAHVTVEAAAAPSPVEPSIAEQATPAEP
IPEGEALWVKMWEMNRVSVAVTMAAVLVLTLIFFFQDWLVKRPALFAWVRRVYLLFTLVW
LGWYANAQLSVVNVLTFFNSLVTGFHWEFFLSAPLVFLLWGSVAAALLFWGRGPFCGWLC
PFGALQELTNNVARWLKVPQVRVPWGLHERLWPIKYIIFLGLFGLSLYSLALAEMFAEVE
PFKTAIILKFAREWPFVVFALTVLAAGLFIERFYCRYLCPLGAALAIPGRIRMFEWLKRW
PECGSPCQRCAKECPVQSIHPEGAINVNECIYCMHCQELYHDDQRCPHMIQVRLKREKFM
ALSTPASRGEAPAKTVVTHKGAPIRKADAAPENPV