Protein Info for SMa1073 in Sinorhizobium meliloti 1021

Annotation: TRm23b IS ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF01695: IstB_IS21" amino acids 10 to 240 (231 residues), 240.7 bits, see alignment E=8.2e-76

Best Hits

Swiss-Prot: 92% identical to Y4PL_SINFN: Putative insertion sequence ATP-binding protein y4pL (NGR_a02000) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to sme:SMa1073)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZB0 at UniProt or InterPro

Protein Sequence (245 amino acids)

>SMa1073 TRm23b IS ATP-binding protein (Sinorhizobium meliloti 1021)
MLAHPTLDKLNAMGLAGMAKAFSELVANGESEHLSHAEWLGLLLEREWSSRYDRKLAARL
RFAKLRHQATPEDVDYRAERGLDRALFMKLLGGDWINAHDNLAICGPSGVGKSWLACALG
HKACRDDRSVLYQRVPRLFAQLALARGDGRYARLQRTLGHVQLLILDDWGLEPLNEQARH
DLLEILEDRYGRKSTIITSQLPVSAWHGVIGDPTYADAILDRLVHNAHRIELSGDSLRRN
LPRKA