Protein Info for SMa0995 in Sinorhizobium meliloti 1021

Annotation: TRm5 transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 PF00872: Transposase_mut" amino acids 1 to 359 (359 residues), 522.6 bits, see alignment E=2.9e-161

Best Hits

Swiss-Prot: 100% identical to TRA5_RHIME: Transposase for insertion sequence element ISRM5 (R02224) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07493, putative transposase (inferred from 100% identity to sme:SMa0995)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZF0 at UniProt or InterPro

Protein Sequence (410 amino acids)

>SMa0995 TRm5 transposase (Sinorhizobium meliloti 1021)
MTKTEGKTASAAVKDILLSNPDGLREVIRTVMQEVLEAEMDEALGAAKGERTPERLGYRS
GHYGRTLITRVGKLELRVPQDRSGHFSTELFERYQRSERALVATLAEMYVQGVSTRKVKA
ITEELCGHAFSASSISAINKRLDESLKAFAERSLEEPFAYLILDARYEKVREAGVVMSQA
VLIAVGIDWDGRRQILSVEMAGRESRSAWKDFLVRLKGRGLKGVELVVSDDHAGLVAAIG
EVIPEAAWQRCYVHFLRNALDHLPRKHGDDCLQELRWLYDRRDLDEAKADLAAWLGKWSV
RYPRLTSWVEETIEQTLTFFRLPRQHHKHLKSTNMLERLNEEIRRRTYVVRIFPNTESCP
TPRPRARRRNPRKLDGGQSLHQHGRPARAQETRTPSSRMTSTHDRPICRT