Protein Info for SMa0953 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF00005: ABC_tran" amino acids 22 to 164 (143 residues), 124.2 bits, see alignment E=6.1e-40 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 36 to 339 (304 residues), 365.1 bits, see alignment E=1.6e-113 PF08402: TOBE_2" amino acids 286 to 364 (79 residues), 57.6 bits, see alignment E=1.1e-19

Best Hits

KEGG orthology group: K11080, mannopine transport system ATP-binding protein (inferred from 100% identity to sme:SMa0953)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZG9 at UniProt or InterPro

Protein Sequence (372 amino acids)

>SMa0953 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MIGQSLSLAGLQKRYGEALAVRELSLEIAAGEFVSLLGPSGSGKTTALTMIAGFESPNAG
KIAIGGRDVTFLAPNHRNIGMVFQKYALFPHLTIRQNVAFPLRMRGRMQKTAIAQRVEEM
LDLVQLSSYAERYPNQLSGGQQQRVALARALAFEPPVLLMDEPLGALDNKLREAMQFEIK
RLQERLGATVVYVTHDQDEAMTMSDRVAIMSNGGLIQVGTPTELYRQPKTEFVADFIGRM
NFLDGDCLDCTAEQTVVRFSERTVLRLRAAANERARKYDVGTALRVAIRPERMRLAKRGD
GGADALPGVVDAAVFIGSTYIFLVRLADRPEVSLQVQVAADGLLPFQRDDEVDIVLDGAA
MHVFPVAERCAA