Protein Info for SMa0864 in Sinorhizobium meliloti 1021

Annotation: nodulation factor exporter subunit NodI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR01288: nodulation ABC transporter NodI" amino acids 54 to 355 (302 residues), 595.6 bits, see alignment E=7.9e-184 PF00005: ABC_tran" amino acids 73 to 216 (144 residues), 121.3 bits, see alignment E=4.6e-39 PF13304: AAA_21" amino acids 181 to 247 (67 residues), 39.9 bits, see alignment E=5.5e-14

Best Hits

Swiss-Prot: 100% identical to NODI_RHIME: Nod factor export ATP-binding protein I (nodI) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K09695, lipooligosaccharide transport system ATP-binding protein (inferred from 100% identity to sme:SMa0864)

Predicted SEED Role

"Nodulation ABC transporter, NodI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See O52618 at UniProt or InterPro

Protein Sequence (355 amino acids)

>SMa0864 nodulation factor exporter subunit NodI (Sinorhizobium meliloti 1021)
MTGNGRVLRQEAENQLSDREMAQEAPRWLEPSPFEWKDQTGLAVKTAIPGAKPTVAIDVA
SVTKSYGDKPVINGLSFTVAAGECFGLLGPNGAGKSTITRMILGMTTPGTGEITVLGVPV
PSRARLARMRIGVVPQFDNLDLEFTVRENLLVFGRYFRMSTREIEAVIPSLLEFARLENK
ADARVSDLSGGMKRRLTLARALINDPQLLILDEPTTGLDPHARHLIWERLRSLLARGKTI
LLTTHIMEEAERLCDRLCVLEAGHKIAEGRPHMLIDEKIGCQVIEIYGGDPHELSALVSP
HARHIEVSGETVFCYASDPEQVRVQLDGRAGVRFLQRPPNLEDVFLRLTGRELKD