Protein Info for SMa0838 in Sinorhizobium meliloti 1021

Annotation: SyrA protein involved in EPS production

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 81 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 59 (30 residues), see Phobius details PF11089: SyrA" amino acids 18 to 55 (38 residues), 67.1 bits, see alignment E=4.9e-23

Best Hits

Swiss-Prot: 100% identical to SYRA_RHIME: Protein SyrA (syrA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 99% identity to smd:Smed_6217)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See O87908 at UniProt or InterPro

Protein Sequence (81 amino acids)

>SMa0838 SyrA protein involved in EPS production (Sinorhizobium meliloti 1021)
MSFRFVCLILWLLLCASSLAIYFALQPCPGFIVTTLACLLLFQLAYFGSVLLLVCLAAIA
QLSARLRIFGIFSENRNHSSK