Protein Info for SMa0792 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF00561: Abhydrolase_1" amino acids 35 to 132 (98 residues), 59.8 bits, see alignment E=4.9e-20 PF12146: Hydrolase_4" amino acids 35 to 253 (219 residues), 34.9 bits, see alignment E=1.6e-12 PF12697: Abhydrolase_6" amino acids 36 to 264 (229 residues), 71.6 bits, see alignment E=2.3e-23

Best Hits

Swiss-Prot: 51% identical to TGND_ACIAD: (E)-2-((N-methylformamido)methylene)succinate hydrolase (tgnD) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 100% identity to sme:SMa0792)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZM7 at UniProt or InterPro

Protein Sequence (277 amino acids)

>SMa0792 hypothetical protein (Sinorhizobium meliloti 1021)
MQTVTSHTSGEGGASLPRKTTARGTAYFEAGNGETLILIHGVGMRLEAWAPQIEAFAKTH
RVFALDMPGHGASEKIPAGSTVRDYVAWFGCFLEDLSIARASIAGHSMGALISGGAVATF
SDRITRVAYLNGVYRRDAAAKAAVLARAEAIRKNGVDAEGPLERWFGEDPESQRARELTR
TWLEMVDPEGYAIAYAAFAGGDEIYADCWPSVECPALFLTGSGDPNSTPEMAKQMASVTP
KGWARIVDGHRHMVNLTAPEIVNALMSEWLTSREKPR