Protein Info for SMa0781 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF13384: HTH_23" amino acids 40 to 87 (48 residues), 26.5 bits, see alignment E=6.6e-10 PF13518: HTH_28" amino acids 43 to 94 (52 residues), 37.3 bits, see alignment E=3.6e-13 PF13551: HTH_29" amino acids 46 to 103 (58 residues), 28.9 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 97% identical to Y4OM_SINFN: Uncharacterized protein y4oM (NGR_a02220) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to sme:SMc02302)

Predicted SEED Role

"elements of external origin; transposon-related functions"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>SMa0781 hypothetical protein (Sinorhizobium meliloti 1021)
MTKEGKPDRLRQMGALNPKPEGVRAPWFREAGFFDPLDLVQVKYEMLRHAREEGTNKADA
AALFGLSRQTYYQAEAAFERDGMSGLLPRTRGPKSAHKLTGEVMRLVEEHLDANGQLQAR
SLADLVHARLGISVHPRSIERAVARKKKR