Protein Info for SMa0762 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator FixK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF00027: cNMP_binding" amino acids 30 to 107 (78 residues), 53.9 bits, see alignment E=2.2e-18 PF13545: HTH_Crp_2" amino acids 138 to 208 (71 residues), 73 bits, see alignment E=2.3e-24 PF00325: Crp" amino acids 159 to 190 (32 residues), 64.2 bits, see alignment 1.1e-21

Best Hits

Swiss-Prot: 97% identical to FIXK_RHIME: Nitrogen fixation regulation protein FixK (fixK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SMa0762)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZP2 at UniProt or InterPro

Protein Sequence (211 amino acids)

>SMa0762 transcriptional regulator FixK (Sinorhizobium meliloti 1021)
MYAAAQAKPQSIEVEHLGPAPMSGPHLVATYKPGREIYAQGDLNDKCYQVSTGAVRVYRL
LSDGRRQVVSFHLPGEMFGFEAGSNHSFFAEAITETTLAIFGRRNMQERSRELLALALTG
MARAQQHLLVIGRQCAVERIAAFLVDLCERQGGGRQLRLPMSRQDIADYLGLTIETVSRV
VTKLKERSLIALRDARTIDIVRLEALRSLCS