Protein Info for SMa0757 in Sinorhizobium meliloti 1021

Annotation: NodD2 nod box-dependent transcription activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF00126: HTH_1" amino acids 8 to 67 (60 residues), 53.4 bits, see alignment E=2e-18 PF03466: LysR_substrate" amino acids 94 to 298 (205 residues), 42.4 bits, see alignment E=5.3e-15

Best Hits

Swiss-Prot: 100% identical to NODD2_RHIME: Nodulation protein D 2 (nodD2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K14657, LysR family transcriptional regulator, nod-box dependent transcriptional activator (inferred from 100% identity to sme:SMa0757)

Predicted SEED Role

"Nodulation protein D (transcriptional regulator, LysR family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P08719 at UniProt or InterPro

Protein Sequence (310 amino acids)

>SMa0757 NodD2 nod box-dependent transcription activator (Sinorhizobium meliloti 1021)
MRFRGLDLNLLVALDALMTERKLTAAARRVKLSQPAMSAAIARLRTYFGDELFSMQGREL
IPTPRAEALAPAVRDALLHIQLSVIAWDPINPAQSDRRFRIILSDFMTLVFFERVVERLA
REAPGVSFELLPLDDDPYELLRRGDVDFLVLPDLFMSSAHPKAKLFAEALVCVGCPTNEQ
LLGELSFEKYMSMGHVAAQFGRALKPSFEQWLLLEHGFKRRVELVVPGFTLIPPLLPHTN
RIAIIPLRLVKYFEQTIPLRIVKHPLPPLWFTEAVQWPALHNKDPGNIWMREILLQEASR
SEFQGETSLE