Protein Info for SMa0710 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 52 to 74 (23 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 201 to 226 (26 residues), see Phobius details amino acids 248 to 272 (25 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 131 to 328 (198 residues), 83.9 bits, see alignment E=6.1e-28

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to sme:SMa0710)

Predicted SEED Role

"FIG01076152: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZS3 at UniProt or InterPro

Protein Sequence (337 amino acids)

>SMa0710 ABC transporter permease (Sinorhizobium meliloti 1021)
MRRPRRFNRRLPPSAHKGKPGAPYVASGPRKKQEAIMSLRFLDLARPSRQHWLGYLLLLP
AVALVALIIVYPLFVSLDLSFQKIGMATLSAPRKPFTLENYHKLFASPDFWNSCWVTIKL
VVVVSAACFAVGLGTALLVNNRFKGRTLARLFVALPWAVPEVIAVVIFAWIFDSSFGLMN
WLFIKLGITSQMINWFSEPTAAFWVVAITMIWKGYPFVSIMTLAGLQSIPEDFYNAAKVD
GANAFQRFWYITIPVLMPVLGVTSVLVVLWVFRDFSIIKVLTDGGPLKATQTLSIMTYDQ
AFGFFNMGYASAIGIVTLVLCVVASLLMLGRKSQAMY