Protein Info for SMa0670 in Sinorhizobium meliloti 1021

Annotation: regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR03707: polyphosphate kinase 2" amino acids 33 to 256 (224 residues), 363.4 bits, see alignment E=2.6e-113 PF03976: PPK2" amino acids 34 to 255 (222 residues), 333.6 bits, see alignment E=3.2e-104

Best Hits

Swiss-Prot: 100% identical to PK21C_RHIME: Polyphosphate:ADP phosphotransferase 3 (SMa0670) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SMa0670)

Predicted SEED Role

"UDP-galactose-lipid carrier transferase (EC 2.-.-.-)" (EC 2.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZU4 at UniProt or InterPro

Protein Sequence (284 amino acids)

>SMa0670 regulatory protein (Sinorhizobium meliloti 1021)
MDKHTDDRKKNNHWKAEDRKSAATEASETRSGGNYAKELARLQEEIAHLQAWVKKTGARI
VIVFEGRDAAGKGGVIKRITERVSPRVFRVVALPAPTDREKTQIYMQRYIQQFPAAGEVV
IFDRSWYNRPGVERVMGFCSEKKAKRFLEIAPRFEAAMIESGIVLLKYFLDVSEEEQDRR
FRQRINDPLRQWKLSPMDVESYRRWWDYTRAYDEMIRMTDTDDAPWWIVPSDNKKQARVN
CIAHILSSIPYERVKFEDPDLGKRQKRPADFEGDTRRRTVPNLF