Protein Info for SMa0657 in Sinorhizobium meliloti 1021

Annotation: cytochrome c binding protein, amino terminus

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 65 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF03264: Cytochrom_NNT" amino acids 2 to 54 (53 residues), 71.1 bits, see alignment E=5.1e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa0657)

Predicted SEED Role

"Cytochrome c-type protein NapC" in subsystem Nitrate and nitrite ammonification or trimethylamine N-oxide (TMAO) reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZV3 at UniProt or InterPro

Protein Sequence (65 amino acids)

>SMa0657 cytochrome c binding protein, amino terminus (Sinorhizobium meliloti 1021)
MTLGGFVGGVIFWGAFNTALELTNTEEFCVSCHEMRANVYEELRRTVHFSNRSGPGVLSR
LPRAA