Protein Info for SMa0617 in Sinorhizobium meliloti 1021

Annotation: FixP3 Diheme c-type cytochrome

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details TIGR00782: cytochrome c oxidase, cbb3-type, subunit III" amino acids 12 to 289 (278 residues), 285.5 bits, see alignment E=2.3e-89 PF14715: FixP_N" amino acids 12 to 57 (46 residues), 61.7 bits, see alignment 6.6e-21 PF00034: Cytochrom_C" amino acids 112 to 196 (85 residues), 44.6 bits, see alignment E=4.3e-15 amino acids 210 to 288 (79 residues), 34.8 bits, see alignment E=5e-12 PF13442: Cytochrome_CBB3" amino acids 112 to 193 (82 residues), 38.3 bits, see alignment E=2e-13 amino acids 209 to 285 (77 residues), 41.4 bits, see alignment E=2.2e-14

Best Hits

Swiss-Prot: 39% identical to FIXP_RHILV: Cbb3-type cytochrome c oxidase subunit FixPc (fixPc) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K00406, cb-type cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 100% identity to sme:SMa0617)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZX5 at UniProt or InterPro

Protein Sequence (293 amino acids)

>SMa0617 FixP3 Diheme c-type cytochrome (Sinorhizobium meliloti 1021)
MDVEEVDPISGRRTTGHEWNGIKELDTPVPRGVLLFLVVTHVFALLWWVLLPTWPLGTTY
TKGLLGIDERNVVEEKLAAAAAARAVWEKRIDTLSYEQIRADEQLMATVRSTGHQLFGDN
CAVCHGIDGKGRSNYPDLTDDDWLWGGGPEDIEQTLRVGINTRHPESRVAQMPSFGREQM
LERNQVRDVAAYVYSLTNPGYSTPENIGRIEAGREVFLTSCAACHGENARGSREVGAPNL
TDAYWIYGGTMQTIIESVHGGRQGHMPTWDERLTSAEIKILALYINSLGVEKP