Protein Info for SMa0612 in Sinorhizobium meliloti 1021

Annotation: cbb3-type cytochrome c oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 370 to 392 (23 residues), see Phobius details amino acids 411 to 432 (22 residues), see Phobius details amino acids 441 to 463 (23 residues), see Phobius details amino acids 496 to 519 (24 residues), see Phobius details TIGR00780: cytochrome c oxidase, cbb3-type, subunit I" amino acids 73 to 530 (458 residues), 632.4 bits, see alignment E=2.7e-194 PF00115: COX1" amino acids 76 to 506 (431 residues), 358 bits, see alignment E=3.9e-111

Best Hits

Swiss-Prot: 57% identical to FIXN_BRADU: Cytochrome c oxidase subunit 1 homolog, bacteroid (fixN) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00404, cb-type cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 100% identity to sme:SMa0612)

MetaCyc: 57% identical to cbb3-1 cytochrome c oxidase subunit N (Pseudomonas putida KT2440)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase subunit CcoN (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ZX8 at UniProt or InterPro

Protein Sequence (551 amino acids)

>SMa0612 cbb3-type cytochrome c oxidase subunit I (Sinorhizobium meliloti 1021)
MGQLTTRERDLAAAILLVLAIVGIAMAAAGRFDPLGVHGAVVLLYSLALLYLIMSSSFGP
PPDPSRISRYYDDPIKAGVWFTLFWAIFGMFIGVWAAAQLAWPSLNFDTAWASFGRIRPA
HTTGVIFGFGGNALIATSFHVVQRTSRARLADQLSPWFVLFGYNLFCILAVTGYFMGVTQ
SKEYAEAEWYADLWLVIVWVTYFILYIRTLARRREPHIYVANWYYMAFIVVVAILHIINN
LTVPVSLGHAKSYTIWSGVQDSMVQWWYGHNAVAFFLTAGFLAMLYYYLPKRAERPIFSY
RLSILSFWGITFFYMWAGSHHLHYTALPHWVQNLGMTFSVMLLVPSWASAGNALLTLNGA
WHKVRDDATLRFIMMAAFFYGLSTFEGSFLAVRPVNSLSHYTDWTVGHVHAGALGWVALI
TYGSLYTLVPAIWKRERMYSAALVEVHFWLAFAGTVIYVFAMWNSGIIQGLMWRTYTGDG
TLAYSFVDSLVAMYPYYIARAFGGLLFLIGAVVATYNIWMTVRGVPALAERHGDVPVAAP
LPEGAATGPAE