Protein Info for SMa0503 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 141 to 166 (26 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 11 to 104 (94 residues), 78.3 bits, see alignment E=2.7e-26 PF00528: BPD_transp_1" amino acids 30 to 211 (182 residues), 51.8 bits, see alignment E=4.4e-18

Best Hits

Swiss-Prot: 31% identical to YCKA_BACSU: Probable amino-acid ABC transporter permease protein YckA (yckA) from Bacillus subtilis (strain 168)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to sme:SMa0503)

MetaCyc: 32% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"ABC transporter, permease"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930D3 at UniProt or InterPro

Protein Sequence (218 amino acids)

>SMa0503 ABC transporter permease (Sinorhizobium meliloti 1021)
MRTFGSPEFLFIVYALRWTLTLTVLAFVGGGIMGIVLALLRIARIRAFSAITTFYMQVIQ
GLPLLVLLFLCYYAPSLFGIEIAALTAAAIALTINSSAFLGAIWESALRAIPKAQWESAD
ALALTPYKTLRFVIAPQAIRLALPSTVGFLVQIIKQTSLASIIGFIEITRAGQLVSNATF
EPLKAFLSVAALYFAVCFPLTQLSLWLERRTACRGART