Protein Info for SMa0492 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 168 to 185 (18 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 116 (107 residues), 89.1 bits, see alignment E=1.1e-29 PF00528: BPD_transp_1" amino acids 32 to 217 (186 residues), 61.1 bits, see alignment E=6e-21

Best Hits

Swiss-Prot: 48% identical to OCCM_RHIML: Octopine transport system permease protein OccM (occM) from Rhizobium meliloti

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to sme:SMa0492)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930E0 at UniProt or InterPro

Protein Sequence (227 amino acids)

>SMa0492 ABC transporter permease (Sinorhizobium meliloti 1021)
MNIGIVFDAIPRMLGGIVMTFQLLLLSLAIGTMIAVLLLLMRISGRWWLSWPAQFYTYVF
RGTPILVQIFIVYYGLPQFEWIRESIFWPILRDPFGCAILALSLNTGAYLSEIFRGGVLA
VERGLLEAGAALGMSATHRFIYITTPLAIRIALPAYGNEVISLMKSTALASTITLVDMTG
IGRTIVAETFAPYQVFLSLAIVYVAITWIIQRSVKRLEVYLGRSTAR