Protein Info for SMa0404 in Sinorhizobium meliloti 1021

Annotation: FMN-dependent dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF01070: FMN_dh" amino acids 13 to 371 (359 residues), 424.5 bits, see alignment E=4.7e-131 PF00478: IMPDH" amino acids 295 to 341 (47 residues), 26.7 bits, see alignment 4.2e-10 PF01645: Glu_synthase" amino acids 301 to 331 (31 residues), 22.2 bits, see alignment (E = 1.1e-08)

Best Hits

KEGG orthology group: K05888, [EC: 1.1.2.-] (inferred from 100% identity to sme:SMa0404)

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.-, 1.1.2.3

Use Curated BLAST to search for 1.1.2.- or 1.1.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930I0 at UniProt or InterPro

Protein Sequence (381 amino acids)

>SMa0404 FMN-dependent dehydrogenase (Sinorhizobium meliloti 1021)
MALVNIDDFRDLARRRRPKIFFDYIDGGSFEEETMRANRSDFSRLTLRQNVLVEPQPQDL
ATAYLGKRHPLPFMLGPVGFLGLYSGKGEVKAVRAAHAAGIPFCLSTFSIASLADLRIVT
DGPLHFQLYVLEDRSLCEEFLRAAEYAGVDTLFVTVDTAITGIRERDVRNGFRSLTRVTP
DLFARLALKPRWLAEVVLAGMPSVRAVEHRPEFGRGALEQAANLSRRIDKTLSWKDIAWL
RERWAGKLVIKGVLTPADAVRARDLGCDGVVVSNHGGRQLDGAPSTIRALPSIRATVGTD
FCLMLDGGIRRGADVIKAIALGADGVMLGRAYAYGLSAAGQAGVAEVIAILEREISISLA
LMGIASVEQLKALGAEAVSTL