Protein Info for SMa0389 in Sinorhizobium meliloti 1021

Annotation: short chain alcohol dehydrogenase-related dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 42% identical to KDUD_DICD3: 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (kduD) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 100% identity to sme:SMa0389)

MetaCyc: 42% identical to KduD (Dickeya dadantii 3937)
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase. [EC: 1.1.1.127]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
palmitate biosynthesis III (28/29 steps found)
superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
oleate biosynthesis IV (anaerobic) (13/14 steps found)
(5Z)-dodecenoate biosynthesis I (6/6 steps found)
palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
fatty acid elongation -- saturated (5/5 steps found)
gondoate biosynthesis (anaerobic) (4/4 steps found)
(5Z)-dodecenoate biosynthesis II (5/6 steps found)
stearate biosynthesis II (bacteria and plants) (5/6 steps found)
cis-vaccenate biosynthesis (4/5 steps found)
8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
stearate biosynthesis IV (4/6 steps found)
8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
biotin biosynthesis I (9/15 steps found)
petroselinate biosynthesis (2/6 steps found)
superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)
2-allylmalonyl-CoA biosynthesis (2/8 steps found)
streptorubin B biosynthesis (20/34 steps found)
mycolate biosynthesis (21/205 steps found)
superpathway of mycolate biosynthesis (22/239 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.127

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930I9 at UniProt or InterPro

Protein Sequence (255 amino acids)

>SMa0389 short chain alcohol dehydrogenase-related dehydrogenase (Sinorhizobium meliloti 1021)
MTSPIFDLSGRRALVTGASRGIGQSIAVALAEAGAHVAVTARTVEGLAETRALIEKTGRR
AVALAQDVRDVEACASVTRAAAEGLGGLDILVNNAGFENVRPSFDVDEALWDTIVSTNLK
GAFFCAQAAGRIMADANGGAIVNLCSLTSYVGIPTAVPYGASKSGLLGVTRALATEWAAH
NIRVNAIAPGYFRTAMTAGFYEDEDWQSRMLEKIPQRRFGKESDIGGVAVFLCSDAAAYI
TGHCIPADGGYLASI