Protein Info for SMa0339 in Sinorhizobium meliloti 1021

Annotation: short chain alcohol dehydrogenase-related dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00106: adh_short" amino acids 8 to 201 (194 residues), 184.9 bits, see alignment E=1.8e-58 PF08659: KR" amino acids 11 to 170 (160 residues), 27.8 bits, see alignment E=3.4e-10 PF13561: adh_short_C2" amino acids 14 to 251 (238 residues), 229.5 bits, see alignment E=6.5e-72

Best Hits

Swiss-Prot: 43% identical to LVR_LEIAQ: Levodione reductase (lvr) from Leifsonia aquatica

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_6598)

MetaCyc: 43% identical to levodione reductase monomer (Leifsonia aquatica)
1.1.1.M48 [EC: 1.1.1.M48]

Predicted SEED Role

"FIG01074987: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.M48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930L3 at UniProt or InterPro

Protein Sequence (257 amino acids)

>SMa0339 short chain alcohol dehydrogenase-related dehydrogenase (Sinorhizobium meliloti 1021)
MSSLFSNKVVTVTGAGSGIGRAIALGLARDGATVHLADRDADGLTQTAELIRAEDGRAFT
TELDVASELQVVGWIEQIGSTSGRLDAAFNNAGITGPAKRIEDYPLEDFQRVIAVNLQSV
FLGMKYQIPLIKRNGGGSIVNTASIAALTGPGGMSAYAASKHGVQGLTRVVAMENAAHGI
RVNAIAPGWTETPMVAANSQQNPAFAALAQNAIPAKRGGKPEEIAAAAIWLASDAASYVT
GHMLTVDGGMTIGGFEL