Protein Info for SMa0326 in Sinorhizobium meliloti 1021

Annotation: short chain alcohol dehydrogenase-related dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF00106: adh_short" amino acids 7 to 193 (187 residues), 180.5 bits, see alignment E=4.1e-57 PF08659: KR" amino acids 9 to 167 (159 residues), 57.1 bits, see alignment E=3.5e-19 PF13561: adh_short_C2" amino acids 16 to 211 (196 residues), 129.3 bits, see alignment E=2.8e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_6603)

Predicted SEED Role

"short chain alcohol dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930L8 at UniProt or InterPro

Protein Sequence (279 amino acids)

>SMa0326 short chain alcohol dehydrogenase-related dehydrogenase (Sinorhizobium meliloti 1021)
MSTQNPKVWLVTGCSTGFGRYIAEHLLEVGEKVVVTARKADKIADLEQKGDALILPLDVI
DRDQCQKVVDAAEAHFGRIDVLINNAGIGFFGAIEETDESNARRLFDVNFFGTANTIHSV
LPHMRARRSGTIVNLTSIGGLVGYTGVGYYCATKFAVEGLSDTLRNEVAPLGINVMTVEP
SAFRTEWAGSSNEVSASIEDYEATAGEARRAYHTSVGKQAGDPARAAKAIREAVLAQQPP
HHLPLGNDAADAALKKAEDLKANVLAWEALSRSADFPAN