Protein Info for SMa0299 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 89 to 115 (27 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 105 to 290 (186 residues), 94.8 bits, see alignment E=2.8e-31

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 99% identity to smk:Sinme_5282)

Predicted SEED Role

"putative ABC transporter permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930N5 at UniProt or InterPro

Protein Sequence (295 amino acids)

>SMa0299 ABC transporter permease (Sinorhizobium meliloti 1021)
MSVITTIPARRFSRFNAERWRATPGPFKVGAVILVAHALFAILGVFWTPYGFAEMGAGLP
LSGASWQHPMGLDQIGRDVFSRFMHGAHIVLMLSFAGTMLGMVAGTTLGLLSGYIGGWFD
EVTQRIVEAMISIPFLALALVMIIAAGPALAGKPVLIVFVVGLVYAPRIVRIARAAAMDI
ATREYVAVAELRGEGTWSIVFREILPNAANVLLVEFSLRLSYAPILIGALGFLGFGIRPP
TPEWGLMISENRNLLIASPVTVFGPGLGLASLVIGFNLFTDGLSRMLGQRPVAGA