Protein Info for SMa0265 in Sinorhizobium meliloti 1021

Annotation: dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 228 to 243 (16 residues), see Phobius details amino acids 266 to 283 (18 residues), see Phobius details PF02615: Ldh_2" amino acids 5 to 328 (324 residues), 342.6 bits, see alignment E=1.2e-106

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_5353)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930Q4 at UniProt or InterPro

Protein Sequence (334 amino acids)

>SMa0265 dehydrogenase (Sinorhizobium meliloti 1021)
MRLPPARLRNLSVALLEKRGVPADSARLQANLLLEAELRGLPSHGLQRLPLLLSRLDKGL
ANPTTRGNGTWRRASFLSVDGERGLGPVVMMDAMRVTRRILKETGLAIAAIRNANHMGML
AYYAEAAARDGLIGIVMSTSEALVHPFGGTQALIGTNPVAIGIPAAGHPFVLDLATSIVS
MGKINNHAMRGLAIPPGWAVDRDGRATTDPHAAQAGAIAPFGDAKGYGLGLAIELLVAAL
AGSNLAPDVNGTLDDIHPANKGDLLILIDPSAGAGSIPALAAYLDRLRLSRPLDPTQPVA
IPGDGARARRAAAAKTGIELPQPLFDHLTALEAA