Protein Info for SMa0250 in Sinorhizobium meliloti 1021

Annotation: dedA-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 34 (28 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 104 (27 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 240 to 256 (17 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 315 to 343 (29 residues), see Phobius details amino acids 355 to 379 (25 residues), see Phobius details amino acids 393 to 419 (27 residues), see Phobius details PF06808: DctM" amino acids 7 to 415 (409 residues), 409.7 bits, see alignment E=6.8e-127 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 418 (402 residues), 451.3 bits, see alignment E=1.3e-139

Best Hits

Swiss-Prot: 47% identical to Y050_HAEIN: Putative TRAP transporter large permease protein HI_0050 (HI_0050) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_5361)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930R2 at UniProt or InterPro

Protein Sequence (425 amino acids)

>SMa0250 dedA-like protein (Sinorhizobium meliloti 1021)
MTLVVFIVSLLGAMAIGVPVAFSLMFCGVVLMWYMGMFNTQIIAQNMIAGADTFTLLAIP
FFILAGELMNAGGLSRRIIDFAIACVGHIRGGLGIVAIMAAVIMASISGSAAADTAALAA
ILIPMMAKAGYNVPRSAGLIAAGGVIAPVIPPSMAFIVFGVAANVSITQLFMAGIVPGLI
MGIALVATWLLVVRKDDIQPLPRTPMKERVGATGRALWALGMPVIILGGIKAGVVTPTEA
AVVAAVYALFVGMVIYRELKPRDLPGVILQAAKTTAVIMFLVCAALVSSWLITAANIPSE
ITGFISPLIDRPTLLMFVIMLVVLVVGTALDLTPTILILTPVLMPIIKQAGIDPVYFGVL
FIMNTCIGLLTPPVGVVLNVVSGVGRVPLGKVIVGVTPFLVAQILVLFLLVLFPDIVIVP
ARWLH