Protein Info for SMa0237 in Sinorhizobium meliloti 1021

Annotation: dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF03446: NAD_binding_2" amino acids 6 to 163 (158 residues), 176 bits, see alignment E=9.2e-56 PF03807: F420_oxidored" amino acids 6 to 97 (92 residues), 40.7 bits, see alignment E=4.4e-14 PF14833: NAD_binding_11" amino acids 166 to 283 (118 residues), 100.1 bits, see alignment E=1.6e-32

Best Hits

Swiss-Prot: 39% identical to GARR_ECOLI: 2-hydroxy-3-oxopropionate reductase (garR) from Escherichia coli (strain K12)

KEGG orthology group: K00042, 2-hydroxy-3-oxopropionate reductase [EC: 1.1.1.60] (inferred from 100% identity to sme:SMa0237)

MetaCyc: 39% identical to tartronate semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
2-hydroxy-3-oxopropionate reductase. [EC: 1.1.1.60]

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.60

Use Curated BLAST to search for 1.1.1.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930R8 at UniProt or InterPro

Protein Sequence (293 amino acids)

>SMa0237 dehydrogenase (Sinorhizobium meliloti 1021)
MSGKTKIAFLGTGLMGAPMARRLLGAGFSVTVWNRDAAKAEPLAADGADIAASPADAVAG
AAIVFTMLTNGQAVSEVLFERGVADSLAEGRIVVDCSSIAPQIAREHARRLAEKGIRHLD
APVSGGVVGAAAGTLAIMAGGDGAAVESLKEVFAVLGRVTHVGPSGAGQVCKLANQQIVA
VTIGAVAEAMVLVEAGGASRAAFRDAIRGGFAESRILELHGARMVERNFAPGGASNNQLK
DLNAVMAMADELSLELPLTRQVRQEFADFVESGGGEQDHSGLLLQLEKLNPRN