Protein Info for SMa0220 in Sinorhizobium meliloti 1021

Annotation: NAD-dependent aldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 PF00171: Aldedh" amino acids 32 to 491 (460 residues), 555.6 bits, see alignment E=4e-171

Best Hits

Swiss-Prot: 41% identical to ALDH_ASPNG: Aldehyde dehydrogenase (aldA) from Aspergillus niger

KEGG orthology group: K00155, [EC: 1.2.1.-] (inferred from 100% identity to sme:SMa0220)

MetaCyc: 48% identical to L-sorbosone dehydrogenase subunit (Gluconobacter oxydans UV10)
1.1.1.M58 [EC: 1.1.1.M58]

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3)" in subsystem Entner-Doudoroff Pathway or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-, 1.2.1.3

Use Curated BLAST to search for 1.1.1.M58 or 1.2.1.- or 1.2.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930S8 at UniProt or InterPro

Protein Sequence (504 amino acids)

>SMa0220 NAD-dependent aldehyde dehydrogenase (Sinorhizobium meliloti 1021)
MLSNFIAPDSNDPRLRIKSRYQMLVDGKSVDAASGSTIDRVSPGHAGEVVGTWPEASADD
VRKAVAAARKAFDAGPWPRMSGAERSRLMFKVADLILARQEELALIESLEVGKPIAQARG
EIGFCADLWSYAAGQARALEGQTHNNIGDDRLGLVLREPVGVVGIITPWNFPFIIASERV
PWAIGSGCTVVLKPSEFTSGTSIRLAELAREAGIPDGVFNVVTGYGDPAGQVLAEDPNVD
MVAFTGSVRVGTKLGEIAARTVKRVGLELGGKGPQIVFADADLDAAADGIAYGVYHNAGQ
CCISGSRLLVQEGIRDALMERLLDISRKVAFGDPLNERTKIGAMISEAHAEKVHSYVTAG
ITSGAELLLGGERIGREAGLYYAPTVFAGVTPDMSIAREEIFGPVLSTLTFKTADEAVAL
ANATEFGLSASVWSTNLETALQTIRRIRAGRCWINSVIDGTPELPIGGYKKSGLGRELGR
YGFDEYSQFKGVHVTLGRPAPWFT