Protein Info for SMa0181 in Sinorhizobium meliloti 1021

Annotation: CspA5 cold shock protein transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 67 PF00313: CSD" amino acids 3 to 66 (64 residues), 85.6 bits, see alignment E=1.7e-28 PF08206: OB_RNB" amino acids 12 to 60 (49 residues), 24.8 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 61% identical to CSPA_RHIME: Cold shock protein CspA (cspA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03704, cold shock protein (beta-ribbon, CspA family) (inferred from 100% identity to smk:Sinme_5400)

Predicted SEED Role

"Cold shock protein CspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930U8 at UniProt or InterPro

Protein Sequence (67 amino acids)

>SMa0181 CspA5 cold shock protein transcriptional regulator (Sinorhizobium meliloti 1021)
MPKGTVKFFNDDKGFGFITPEDGGTDVFVHVSALQHGGSLKEGDKVSYDVGQDRKTGKSK
AENVSVL