Protein Info for SMa0163 in Sinorhizobium meliloti 1021

Annotation: PilQ2 pilus assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF13629: T2SS-T3SS_pil_N" amino acids 42 to 112 (71 residues), 59.1 bits, see alignment E=4.3e-20 PF04972: BON" amino acids 118 to 175 (58 residues), 43.5 bits, see alignment 4.7e-15 PF00263: Secretin" amino acids 246 to 407 (162 residues), 138.8 bits, see alignment E=2e-44

Best Hits

KEGG orthology group: K02280, pilus assembly protein CpaC (inferred from 100% identity to smk:Sinme_5413)

Predicted SEED Role

"Type II/IV secretion system secretin RcpA/CpaC, associated with Flp pilus assembly" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930V8 at UniProt or InterPro

Protein Sequence (466 amino acids)

>SMa0163 PilQ2 pilus assembly protein (Sinorhizobium meliloti 1021)
MTRSRGSLFAFFCFVVALCTGIGVSPPASANGDSVEISSNFSRSIKVAKGKTVTIRAVQR
FDEIVIGDPEIATVTPLTDRSFYILGNELGSTSVTIFDAEKNPVGIIDIEVTLDTKLLSS
TIRQSVPGSSVKVTSANGRIVLSGSATDAVAATQAEQIASRFAGDEEVINSIKITSSQQV
QLNVRFVEINRDVGKELGTQISAAYAWSNGSVEFNSSPRATSNTPAGSLIGSLIGEGYSV
DVAIDALEDRGMARRLAEPNLIARSGETSSFLAGGEFPIPISEQDGTITVSYKKFGVGLD
FTPTVLSDGLIALDIEPEVSAIDNTASYRVGNIAIPGFSVRRARTSVDLKSGQSFMIAGL
LQSENNLITQRVPGLGQLPILGALFSSKAYQRRETDLVIIVTPHLVKPIDPLKKVASPSD
RTKRPTEAEFFLGNIDEVEVNGRGRSASRQARVVRAPSSGHFLELQ