Protein Info for SMa0143 in Sinorhizobium meliloti 1021

Annotation: RNA polymerase ECF sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 13 to 162 (150 residues), 95.3 bits, see alignment E=1.6e-31 PF22029: PhyR_sigma2" amino acids 14 to 65 (52 residues), 47.2 bits, see alignment E=4.6e-16 PF04542: Sigma70_r2" amino acids 14 to 77 (64 residues), 60.8 bits, see alignment E=2.2e-20 PF07638: Sigma70_ECF" amino acids 36 to 160 (125 residues), 24.8 bits, see alignment E=4.6e-09 PF08281: Sigma70_r4_2" amino acids 109 to 159 (51 residues), 62.4 bits, see alignment E=6.2e-21 PF04545: Sigma70_r4" amino acids 112 to 159 (48 residues), 40.1 bits, see alignment E=5.3e-14

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to smk:Sinme_5424)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q930W9 at UniProt or InterPro

Protein Sequence (180 amino acids)

>SMa0143 RNA polymerase ECF sigma factor (Sinorhizobium meliloti 1021)
MSNAVKDVGERLMAFLPNLRRFAISLCGSRDVADDLVQSACERALASAERFEPGTRFDAW
IFRILRNLWIDQVRRQKTAGVQDDITERHDIAGSSGERETEARLTLKTVAEAITELPDEQ
REVVLLVCVEELSYREAADVMGIPIGTVMSRLMRARRSLAEAAGITQATGRSQSMKGANE