Protein Info for SMa0067 in Sinorhizobium meliloti 1021

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 23 to 284 (262 residues), 136 bits, see alignment E=1.8e-43

Best Hits

KEGG orthology group: K02058, simple sugar transport system substrate-binding protein (inferred from 100% identity to sme:SMa0067)

Predicted SEED Role

"sugar ABC transporter, periplasmic sugar-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q931B1 at UniProt or InterPro

Protein Sequence (320 amino acids)

>SMa0067 ABC transporter substrate-binding protein (Sinorhizobium meliloti 1021)
MIAGTALGLTLMAPAASAEGLSIAFISHSSASNTFWQAVKKGYDDACEKVGASCQLILTQ
TEGAVEQAVANLQAAIASRPDAIFVAIVDNNAYDNVIKEAVDAGILVLAVNVDDSEGAKG
NARKAFIGQGFTAAGYSLAKAQSENFPKDGPLNLLVGVNAPGQTWSEQRAGGVTKFLEEY
KAEHSDREVNITRIDSATDLALTADRIGAYLNANPDTAAYFDTGYWHAGVAKVLKDRGIE
PGKVLLGGFDLVPEVLQQMEAGYVQVQVDQQPYMQGFIPVMQAYLWKTAGLTPSDVDTGQ
GIVTPKDVPTILELAKQGLR