Protein Info for SMa0045 in Sinorhizobium meliloti 1021

Annotation: carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00194: Carb_anhydrase" amino acids 38 to 243 (206 residues), 138.3 bits, see alignment E=1.9e-44

Best Hits

Swiss-Prot: 37% identical to NEC3_NICLS: Bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3 (NEC3) from Nicotiana langsdorffii x Nicotiana sanderae

KEGG orthology group: K01674, carbonic anhydrase [EC: 4.2.1.1] (inferred from 100% identity to sme:SMa0045)

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q931C3 at UniProt or InterPro

Protein Sequence (249 amino acids)

>SMa0045 carbonic anhydrase (Sinorhizobium meliloti 1021)
MERRDFLRGLALLAACPLCVKTAYAAEGVHWRYEGEEGPEHWGSLAKENSACSAGSQQSP
IDIRGAVKADIPELTADWKSGGTILNNGHTIQVNAAGGTLRRGDKSYDLVQYHFHSPSEH
FVDGKSFPMEAHFVHKNAETGTLGVLGVFLVPGAANSTFASLAEKFPRNPGEESPLITID
PKGLLPSSLSYWTYEGSLTTPPCSEIVDWMVAMEAVEVDPGDIKKFTALYSMNARPALAG
NRRYVLSSS