Protein Info for SMa0028 in Sinorhizobium meliloti 1021

Annotation: selenophosphate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR00476: selenide, water dikinase" amino acids 7 to 316 (310 residues), 419.3 bits, see alignment E=4.6e-130 PF00586: AIRS" amino acids 50 to 156 (107 residues), 89.9 bits, see alignment E=1.5e-29 PF02769: AIRS_C" amino acids 169 to 341 (173 residues), 58 bits, see alignment E=1.4e-19

Best Hits

Swiss-Prot: 100% identical to SELD_RHIME: Selenide, water dikinase (selD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01008, selenide, water dikinase [EC: 2.7.9.3] (inferred from 100% identity to sme:SMa0028)

Predicted SEED Role

"Selenide,water dikinase (EC 2.7.9.3)" in subsystem Selenocysteine metabolism (EC 2.7.9.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.9.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q931D0 at UniProt or InterPro

Protein Sequence (349 amino acids)

>SMa0028 selenophosphate synthetase (Sinorhizobium meliloti 1021)
MNTLAPRLTDLAHGGGCGCKLAPSVLQQLLANQPAARPFAQLLVGNDMADDAAVWQVDDN
TCVIATTDFFMPIVDDPRDFGRIAATNAISDVYAMGGKPILALAIVGMPINKLDSTTIAK
ILEGGASICAEAGIPVAGGHSIDSVEPIYGLAVIGLCHPSEVRRNGGVKAGDALILTKGI
GVGIYSAAIKKNALPPGCYEEMIGSTTLLNRIGADLAADPDVHALTDVTGFGVLGHGLEM
ARASQLSLTLRLSAIPFLSQAYMLAEQGFITGASGRNWASYGADVVLPDDLPDWQRLLLA
DPQTSGGLLVACAPEKAGALVEKVRLAGYPLAGIVGTAAAGAAQIKVIS