Protein Info for SMa0011 in Sinorhizobium meliloti 1021

Annotation: selenocysteine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 PF12390: Se-cys_synth_N" amino acids 7 to 46 (40 residues), 44.5 bits, see alignment 2e-15 TIGR00474: L-seryl-tRNA(Sec) selenium transferase" amino acids 7 to 457 (451 residues), 594 bits, see alignment E=1e-182 PF03841: SelA" amino acids 80 to 447 (368 residues), 571 bits, see alignment E=1.7e-175

Best Hits

Swiss-Prot: 100% identical to SELA_RHIME: L-seryl-tRNA(Sec) selenium transferase (selA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01042, L-seryl-tRNA(Ser) seleniumtransferase [EC: 2.9.1.1] (inferred from 100% identity to smk:Sinme_5501)

MetaCyc: 57% identical to selenocysteine synthase (Escherichia coli K-12 substr. MG1655)
L-seryl-tRNA(Sec) selenium transferase. [EC: 2.9.1.1]

Predicted SEED Role

"L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1)" in subsystem Selenocysteine metabolism (EC 2.9.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P58226 at UniProt or InterPro

Protein Sequence (466 amino acids)

>SMa0011 selenocysteine synthase (Sinorhizobium meliloti 1021)
MSGPVDLRALPSVDQMLNAAAVSPLVEQHGRAVVTDELRKVLGEVRLAVRSGGALPGKDG
IVAALLSRLDDRSRSNLRPLFNLTGTVLHTNLGRALLAQEAVDAAVDAMREAAALEFDLD
SGGRGERDSHLRELLCELTGAEDATVVNNNAAAVLIALNSVGAGRQAIVSRGELIEIGGA
FRMPDIMERAGVDLVEVGTTNRTHAKDYVKAIGPETALILKVHTSNYRIEGFTAEVPGAE
LAAIAHERGVVLLNDLGSGSLVDLSRYGLGREPTVREAVAEGADLVTFSGDKLLGGPQAG
FIVGRRDLIAEINRNPLKRALRVDKIRIAATAATLKLYRDPDRLASRLPTLFMLSRVQAE
VRAQAERLAPQVGAMLAPSGYAVEVCSCSSQIGSGALPVDTIPSAGLRIVGSSGSALEAL
AALFRSLSRPILGRLRDGALVLDLRCLSDEAEFLKTLSEGSGDAVA