Protein Info for SM_b22023 in Sinorhizobium meliloti 1021

Annotation: molecular chaperone GroES

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00166: Cpn10
  • amino acids 3 to 94 (92 residues), 126.6 bits, E=1.5e-41

Best Hits

Swiss-Prot: 100% identical to CH105_RHIME: 10 kDa chaperonin 5 (groS5) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K04078, chaperonin GroES (inferred from 99% identity to smk:Sinme_4706)

MetaCyc: 52% identical to cochaperonin GroES (Escherichia coli K-12 substr. MG1655)
Non-chaperonin molecular chaperone ATPase. [EC: 3.6.4.10, 5.6.1.7]

Predicted SEED Role

"Heat shock protein 60 family co-chaperone GroES" in subsystem GroEL GroES

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.4.10 or 5.6.1.7

Sequence Analysis Tools

See B2FDD5 at UniProt or InterPro

Protein Sequence (104 amino acids)

>SM_b22023 molecular chaperone GroES (Sinorhizobium meliloti 1021)
MAFRPLHDRILVRRVESEEKTKGGIIIPDTAKEKPQEGEVLAVGPGARGEQGQIQPLDVK
VGDRILFGKWSGTEIKIDGEDLLIMKESDVMGIIEARAAEKIAA