Protein Info for SM_b21653 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for Lactose, permease component 1
Rationale: Specific phenotypes on Beta-Lactose. Not important for arabinose utilization but there is no other clear arabinose tranpsorter so who knows (KEGG_correct)
Original annotation: lactose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 14 to 39 (26 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 269 to 292 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 294 (208 residues), 60.4 bits, see alignment E=9.6e-21

Best Hits

Swiss-Prot: 74% identical to LACF_RHIRD: Lactose transport system permease protein LacF (lacF) from Rhizobium radiobacter

KEGG orthology group: K10189, lactose/L-arabinose transport system permease protein (inferred from 100% identity to sme:SM_b21653)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XF9 at UniProt or InterPro

Protein Sequence (298 amino acids)

>SM_b21653 ABC transporter for Lactose, permease component 1 (Sinorhizobium meliloti 1021)
MVRARRGIGRYYDVNGWLFVAPALGLITLFMVYPIAWSLWMSFQSGRGMTLKFAGFANIV
RLWNDPVFIKALTNTMTYFVVQVPIMILLALILASLLNNPRLVGRGVFRTAIFLPCVSSL
VAYSVLFKGMFATDGIVNSTLQAIGLAASPIPWLTHPFWAKVLVILAITWRWTGYNMIFY
LAALQNIDKSIYEVARIDGVPAWARLTHLTIPLLKPVILFTTVISTIGTLQLFDEVYNLT
EGKGGPSNATLTLSLYIYNLTFRFMPNLGYAATVSYVIVVLVALLAFVQFFAARERDR