Protein Info for SM_b21644 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for D-Raffinose, ATPase component
Rationale: Specific phenotype on D-Raffinose pentahydrate.
Original annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 PF00005: ABC_tran" amino acids 45 to 205 (161 residues), 110 bits, see alignment E=4.4e-35 amino acids 324 to 476 (153 residues), 108 bits, see alignment E=1.8e-34 PF13304: AAA_21" amino acids 165 to 240 (76 residues), 27.6 bits, see alignment E=8.5e-10 PF08352: oligo_HPY" amino acids 257 to 282 (26 residues), 15.4 bits, see alignment (E = 6e-06) amino acids 527 to 554 (28 residues), 16.5 bits, see alignment (E = 2.8e-06)

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to sme:SM_b21644)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TF7 at UniProt or InterPro

Protein Sequence (556 amino acids)

>SM_b21644 ABC transporter for D-Raffinose, ATPase component (Sinorhizobium meliloti 1021)
MVTIESIVPAPEERRDRDMKDERPVIDARKVAVSFKVENGTVQAVKDVSFQLYRGETVAI
VGESGSGKSVTARTVMGLLSKRATIAPQARIEYDGRDVLKFSKRERRALRGDRISMIFQE
PMSSLNPVYTIGSQIIEAIRAHRRVSRRAAAERALELLRHVQIPDPEARLNQYPHQLSGG
QRQRVMIAMALANDPDVLIADEPTTALDVTVQAQILNLIRKLQQELGMAVILITHDLTVV
RQFSDYVYVMQLGEVKEHNTTEALFADPQHAYTRRLLSSEPSGSANPLPDDAPILLDGRN
VRVSFTLKKGGFFRPEFKELVAVDGLSLNLRRHETLGLVGESGSGKTTFGQALIRLLNTD
GGEIYFEGEPIHDKDRKGMRPLRSKIQIVFQDPFSSLNPRMSVGQIIEEGLIVNGMGENR
KDRLKRVEDALVSAGMPSNILSRFPHEFSGGQRQRIAIARAVALEPEFILLDEPTSALDL
SVQAQIIELLRRLQDERGLSYLVISHDLKVVRALCHRVVVMQDGKIVEEGPVSEVLNNPK
TAYTERLVKAAFEVAA