Protein Info for SM_b21641 in Sinorhizobium meliloti 1021

Annotation: ArsR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF07848: PaaX" amino acids 26 to 94 (69 residues), 105.5 bits, see alignment E=1.3e-34 TIGR02277: phenylacetic acid degradation operon negative regulatory protein PaaX" amino acids 29 to 292 (264 residues), 358.7 bits, see alignment E=1.2e-111 PF08223: PaaX_C" amino acids 180 to 269 (90 residues), 75.3 bits, see alignment E=4.1e-25

Best Hits

KEGG orthology group: K02616, phenylacetic acid degradation operon negative regulatory protein (inferred from 99% identity to smk:Sinme_4184)

Predicted SEED Role

"Phenylacetic acid degradation operon negative regulatory protein PaaX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TG0 at UniProt or InterPro

Protein Sequence (306 amino acids)

>SM_b21641 ArsR family transcriptional regulator (Sinorhizobium meliloti 1021)
MQANGENSAEQGSRIIRPILDETPLRAASFIVTIYGDVVEPRGGAIWIGNLIEICAGVGI
SETLVRTAVSRLVAAGQLAGEREGRRSFYRLTDAARAEFAAAARVIFGPPEEASWHFVQL
MGSSAEERMQMLERSGHARLGPRLAVGVRPFPSAIMPAVVFRAEPAQGASELKAFASGCW
DLGPHAQAYRRFLACFGKLAVLPDTARAIAPAECLSARLLMVHQFRFVTLREPRLPAEIL
PADWPGDEARRLFARLYRSLSPQADLHVARNCVTLTGPLPKATGATEHRLRMLCGEAAPG
KSGNPV