Protein Info for SM_b21602 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 68 to 93 (26 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details amino acids 241 to 258 (18 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 260 (177 residues), 58.6 bits, see alignment E=3.6e-20

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_4669)

MetaCyc: 34% identical to ABC-type sulfoquinovose transporter permease subunit (Clostridium sp. MSTE9)
7.5.2.-

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UQ2 at UniProt or InterPro

Protein Sequence (274 amino acids)

>SM_b21602 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MQRKSIGNILLLLLTLCVACMWAFPLYWAAVTSMKPEQEVISKTTFIPDVFNFSAYYFAL
FETNLATWYVNSLVTSITVTVVVILISVMCAYALSQIVFPGRRLLYGIILASFMVPSQAL
VVSQFVLMYRFGLINSWGGIILPQLIVPVVVIVYKQFFDSVPKELREAAKLDGCGDFQIL
FRLYLPLNWGITTALAIITYIMAWNAFLWPFLVTNSEEMMTVTVGITQVDDAFGVKYARD
MAVAILAAMPVALAYLLFQKRVTQALMLSSGIKG