Protein Info for SM_b21589 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 159 to 187 (29 residues), see Phobius details amino acids 208 to 236 (29 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 301 to 317 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 47 to 312 (266 residues), 145.3 bits, see alignment E=1e-46

Best Hits

Swiss-Prot: 62% identical to YTFT_ECOLI: Inner membrane ABC transporter permease protein YtfT (ytfT) from Escherichia coli (strain K12)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to sme:SM_b21589)

MetaCyc: 62% identical to galactofuranose ABC transporter putative membrane subunit YtfT (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Putative sugar ABC transport system, permease protein YtfT"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UR4 at UniProt or InterPro

Protein Sequence (341 amino acids)

>SM_b21589 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MIPIMRTYAGRLLPQLIALAAIVVAISIVFPGFLNLQIQNGRLYGSMVDILNRGAPVVLL
AIGMTVVIATKGIDLSVGAVMAICGAVAASLITSGHSLAETLLATLAVGIVCGIWNGVLV
AVLDIQPIIATLVLMVAGRGIAQLITEGTILTFNDPGLIFIGSGSFAGLPMPLVIWLVFG
LLVALLVRRTALGMLIEAIGINRQASTLSGVLTPVLLVAAYVLSGLCAAIAGIIAAADIR
GADANNAGLWLELDAILAVVVGGTSLLGGRFSIAASVLGAVIIQAINTGILLSGFPPEFN
LIIKAAIIIFILVLQSPRFRTGVSFLSIPKAASKPTEREAK