Protein Info for SM_b21558 in Sinorhizobium meliloti 1021

Annotation: aldehyde or xanthine dehydrogenase, iron-sulfur subunit protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF00111: Fer2" amino acids 58 to 109 (52 residues), 32.9 bits, see alignment E=4.9e-12 PF01799: Fer2_2" amino acids 126 to 198 (73 residues), 95.6 bits, see alignment E=1.6e-31

Best Hits

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 100% identity to smk:Sinme_4714)

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UT9 at UniProt or InterPro

Protein Sequence (207 amino acids)

>SM_b21558 aldehyde or xanthine dehydrogenase, iron-sulfur subunit protein (Sinorhizobium meliloti 1021)
MTDETAELHPPGLTMSRREALQATAGAVAFAALPLPAEAAADSTATPAPPTHTLPLEVTV
NGRVHQLVVDPRLSVLDMLRERLSLTGTKKGCNQGACGACTVLIDGQRVNACLALAVMYD
GAKITTIEGVAEGEALHPLQVAFIEHDAFQCGYCTSGQIMSGLGCISEGHASSAEEISYW
MSGNICRCGAYPGIVAAVAQAAKEDRT