Protein Info for SM_b21557 in Sinorhizobium meliloti 1021

Annotation: aldehyde or xanthine dehydrogenase, molybdopterin binding subunit protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00941: FAD_binding_5
  • amino acids 3 to 216 (214 residues), 148.7 bits, E=1.5e-47
• PF03450: CO_deh_flav_C
  • amino acids 225 to 316 (92 residues), 57.4 bits, E=1.4e-19

Best Hits

KEGG orthology group: K11178, xanthine dehydrogenase YagS FAD-binding subunit [EC: 1.17.1.4] (inferred from 100% identity to sme:SM_b21557)

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, FAD binding subunit YagS" in subsystem Purine Utilization

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (11/11 steps found)
• adenosine nucleotides degradation II (5/5 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• superpathway of purines degradation in plants (14/18 steps found)
• ureide biosynthesis (6/7 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• caffeine degradation III (bacteria, via demethylation) (2/7 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (2/10 steps found)
• theophylline degradation (1/9 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

See Q92UU0 at UniProt or InterPro

Protein Sequence (325 amino acids)

>SM_b21557 aldehyde or xanthine dehydrogenase, molybdopterin binding subunit protein (Sinorhizobium meliloti 1021)
MRPFEFQRAASESEAIAAGAAGARYLAGGTTLVDLMREEVETPEKIVDINRLPLNYIRAT
DEAIVIGALARMSEVAANQDVRRLQPLIPETLTEGASPQLRNVASIGGNLLQRVRCPYFR
MLDAPCNKRVPGSGCSAIDGLNAGHAILGTSEHCVATHPSDLAVSLVALGAMLSLKGPRG
ERTIPVEELFRLPESTPHLEHTLEPGELIVEVHIPNGPYARKARYLKVRDRSSYEFALVS
AAAALHVENGIIKEVRIAAGGVGTRPWRMNAVEQALVGKPAARASYEIAAAVSTEETRPL
SHNGFKVKLLPATIVRALEMAGDVA